(data stored in ACNUC9435 zone)

EMBL: AM039951.PE53

AM039951.PE53        Location/Qualifiers
FT   CDS             61211..62170
FT                   /transl_table=11
FT                   /locus_tag="XCVd0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19865.1"
FT                   /translation="MSRKMSIRRATEDLPMIGRTTTNSRDFEETIGRYFARAIPEGTFT
FT                   EVDRKLPADCHELCRLFRMRPVTLHYGGSDKTLQFEAMVINDRFDKRIFLTNHAKEPLR
FT                   AVIGHELTHRMQIERPDLYRELATAIAAAGVDQERWQAYVQLMRAKSGREGRQLSIGEL
FT                   RSEAVADMVGDLLLDRRLWDALRAPSLAQRVVGWVQSAWRRLTAQAAVQAPLGGAPLAK
FT                   DRLAAITAATVVLQRWAHDVANDPVRRAGLHAVGASCRRAGLRHEADPAAEVIRFTNVA
FT                   GDLVAPDQLPVEVAEAVAALNQTTGELWRAADSVEMRP"
     MSRKMSIRRA TEDLPMIGRT TTNSRDFEET IGRYFARAIP EGTFTEVDRK LPADCHELCR        60
     LFRMRPVTLH YGGSDKTLQF EAMVINDRFD KRIFLTNHAK EPLRAVIGHE LTHRMQIERP       120
     DLYRELATAI AAAGVDQERW QAYVQLMRAK SGREGRQLSI GELRSEAVAD MVGDLLLDRR       180
     LWDALRAPSL AQRVVGWVQS AWRRLTAQAA VQAPLGGAPL AKDRLAAITA ATVVLQRWAH       240
     DVANDPVRRA GLHAVGASCR RAGLRHEADP AAEVIRFTNV AGDLVAPDQL PVEVAEAVAA       300
     LNQTTGELWR AADSVEMRP                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page