(data stored in ACNUC9435 zone)

EMBL: AM039951.PE55

AM039951.PE55        Location/Qualifiers
FT   CDS             complement(65905..66366)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19867.1"
FT                   /translation="MVIRASAFVIKKDIDVPLGSVFAFEESWFFRAQVDDGGDIQEVGI
FT                   NLTDGAKYVVLTNPTSALTLAHGLALELRVIGPIRGPGKPPLASLAWSINGGPAISMVD
FT                   YFLALDGGKETTDVRTKHAFFATHWGAWVIDSNGKPISPDPLFVIGSDS"
     MVIRASAFVI KKDIDVPLGS VFAFEESWFF RAQVDDGGDI QEVGINLTDG AKYVVLTNPT        60
     SALTLAHGLA LELRVIGPIR GPGKPPLASL AWSINGGPAI SMVDYFLALD GGKETTDVRT       120
     KHAFFATHWG AWVIDSNGKP ISPDPLFVIG SDS                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page