(data stored in ACNUC9435 zone)

EMBL: AM039951.PE58

AM039951.PE58        Location/Qualifiers
FT   CDS             complement(68066..69109)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19870"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19870.1"
FT                   /translation="MAESSRITSTEVFDAIEKLLAAGQPPTHMSVREMLGGRGSGPVLS
FT                   KFIARWFEEHGAEFFIKVGDARSRKPITDIGSQIRHAAEQAAQVLSEAERQRQEALCAR
FT                   ETAAEQRSVMLDAREEALFAAQAKLAERESEQERLIHELQSDKTNLVSRLDQARLDRLQ
FT                   VESELRELSSAIAGVRDELALALQEIAVSQEREQASQLALAEARRERDAASKRFERFED
FT                   AYAKILNAIHLLRESGQEQGTNLLEALQKLSERLELHQTQLDASAAELAAASRRARTLE
FT                   GKLSQSEMKLAAAHGEARTLSAALVERMHMIDQLRAERDAAIALATSVSSSLATISKQV
FT                   ERDGHHG"
     MAESSRITST EVFDAIEKLL AAGQPPTHMS VREMLGGRGS GPVLSKFIAR WFEEHGAEFF        60
     IKVGDARSRK PITDIGSQIR HAAEQAAQVL SEAERQRQEA LCARETAAEQ RSVMLDAREE       120
     ALFAAQAKLA ERESEQERLI HELQSDKTNL VSRLDQARLD RLQVESELRE LSSAIAGVRD       180
     ELALALQEIA VSQEREQASQ LALAEARRER DAASKRFERF EDAYAKILNA IHLLRESGQE       240
     QGTNLLEALQ KLSERLELHQ TQLDASAAEL AAASRRARTL EGKLSQSEMK LAAAHGEART       300
     LSAALVERMH MIDQLRAERD AAIALATSVS SSLATISKQV ERDGHHG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page