(data stored in ACNUC9435 zone)

EMBL: AM039951.PE59

AM039951.PE59        Location/Qualifiers
FT   CDS             complement(69109..69321)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19871"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19871.1"
FT                   /translation="METKVFRTVVFEMTDAAKGQAFMKPLIEALGEDVEVAPGVRVTAV
FT                   SLRDEITAIETMEAGIDSAQVRVSL"
     METKVFRTVV FEMTDAAKGQ AFMKPLIEAL GEDVEVAPGV RVTAVSLRDE ITAIETMEAG        60
     IDSAQVRVSL                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page