(data stored in ACNUC9435 zone)

EMBL: AM039951.PE60

AM039951.PE60        Location/Qualifiers
FT   CDS             complement(69321..69668)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19872.1"
FT                   /translation="MSPYEAALQWIMSNPGSGSANSLAKLMMSLWNSRCAFAVSECVWN
FT                   LDGARSELALRAIERYLKEGETPEFNRVCEQIHEAHPRLWELGDAASRAKAQLREKWEL
FT                   EDRRNEDEEQN"
     MSPYEAALQW IMSNPGSGSA NSLAKLMMSL WNSRCAFAVS ECVWNLDGAR SELALRAIER        60
     YLKEGETPEF NRVCEQIHEA HPRLWELGDA ASRAKAQLRE KWELEDRRNE DEEQN            115
//

If you have problems or comments...

PBIL Back to PBIL home page