(data stored in ACNUC9435 zone)

EMBL: AM039951.PE61

AM039951.PE61        Location/Qualifiers
FT   CDS             complement(69689..72637)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19873.1"
FT                   /translation="MNENALVVSAVEHGESSRFERLDAPRPGTYWRLLQDVTGEEDGKQ
FT                   IESNPLDAGIVLLLESIEYADGEPHVYKFAAHPGVPEREAYPSLFHADCFWRYWTYCPE
FT                   AALVRERELLALHQEMAQTQARLLEPPPAAKPIANLGYDPSAPTQSEGQALATPEQLRD
FT                   MTVYAERLKKNAEATQKWIAKHSEALKGQGEALARFHMERATVGLAAAQGQLDAVKGIL
FT                   RTVENLKIYTGDGVEVTQLRKGAPAPAELPLTIYQELLSLDEELLLHLEVNGLDHTHLD
FT                   SVATVLADDALLQRLVPAARGMVLCQFRSSYKEFVKPSRPGDIGAAMANQQLNKISQLH
FT                   MLLVRDGEQVYLVEGPEFLQKIKQLMPNAAEQLGHFSGRNGETIRRDDLAYAMAQRRQL
FT                   GALDAYAKVLTMLWGLRDRDVLFADWAVPAFASWLDWGFQERYLRLVDQSVMLGVERPG
FT                   YDAYRQQQNQYLAAGAWVAVRASALFEQRFIPGAFASQETRQFNNRWAHSRVYVLKQRM
FT                   PIIGCVRRDKRGDYIEVPLVHEGYNRSGREITGKLYLCREAMQEVLVLDRVDASDLTYY
FT                   LTSRAQRRSYNDYIQLFQAARTWVAERDSAEGPLRAELRQAVAAARIPHDADALEGAIT
FT                   AALAVARTARRDKCSPAPDSSSYSAYRKGALDTLHALLTDQAGRTAAVDAWCQRQGRRP
FT                   LRLVSTGKGQFKVYLEPVASEHQVLLGDARHASSAAVTFDPHTGEAVLGGWQRELLRAS
FT                   ASEHVIHDWKYITRFAGDPAATSYLDRHDRTIDDGAAKWLAHKSLLGTLRYDQAESLLA
FT                   LPVKQSDSFRRGLDMANLASHAISSRSNKIVRHRLRFAIGIVHARGRPCMLMAEHDSLA
FT                   YCYENANAAGKQACVDLIRAWYKTPEPAVQRLVQGELDWTPCYVDLSAVWTYRDQARCD
FT                   DLDHSGTVFESNVLDPALSEKENSERDIRCMGLTSVGAELFPWLASRTLQAL"
     MNENALVVSA VEHGESSRFE RLDAPRPGTY WRLLQDVTGE EDGKQIESNP LDAGIVLLLE        60
     SIEYADGEPH VYKFAAHPGV PEREAYPSLF HADCFWRYWT YCPEAALVRE RELLALHQEM       120
     AQTQARLLEP PPAAKPIANL GYDPSAPTQS EGQALATPEQ LRDMTVYAER LKKNAEATQK       180
     WIAKHSEALK GQGEALARFH MERATVGLAA AQGQLDAVKG ILRTVENLKI YTGDGVEVTQ       240
     LRKGAPAPAE LPLTIYQELL SLDEELLLHL EVNGLDHTHL DSVATVLADD ALLQRLVPAA       300
     RGMVLCQFRS SYKEFVKPSR PGDIGAAMAN QQLNKISQLH MLLVRDGEQV YLVEGPEFLQ       360
     KIKQLMPNAA EQLGHFSGRN GETIRRDDLA YAMAQRRQLG ALDAYAKVLT MLWGLRDRDV       420
     LFADWAVPAF ASWLDWGFQE RYLRLVDQSV MLGVERPGYD AYRQQQNQYL AAGAWVAVRA       480
     SALFEQRFIP GAFASQETRQ FNNRWAHSRV YVLKQRMPII GCVRRDKRGD YIEVPLVHEG       540
     YNRSGREITG KLYLCREAMQ EVLVLDRVDA SDLTYYLTSR AQRRSYNDYI QLFQAARTWV       600
     AERDSAEGPL RAELRQAVAA ARIPHDADAL EGAITAALAV ARTARRDKCS PAPDSSSYSA       660
     YRKGALDTLH ALLTDQAGRT AAVDAWCQRQ GRRPLRLVST GKGQFKVYLE PVASEHQVLL       720
     GDARHASSAA VTFDPHTGEA VLGGWQRELL RASASEHVIH DWKYITRFAG DPAATSYLDR       780
     HDRTIDDGAA KWLAHKSLLG TLRYDQAESL LALPVKQSDS FRRGLDMANL ASHAISSRSN       840
     KIVRHRLRFA IGIVHARGRP CMLMAEHDSL AYCYENANAA GKQACVDLIR AWYKTPEPAV       900
     QRLVQGELDW TPCYVDLSAV WTYRDQARCD DLDHSGTVFE SNVLDPALSE KENSERDIRC       960
     MGLTSVGAEL FPWLASRTLQ AL                                                982
//

If you have problems or comments...

PBIL Back to PBIL home page