(data stored in ACNUC9435 zone)

EMBL: AM039951.PE62

AM039951.PE62        Location/Qualifiers
FT   CDS             complement(72647..72871)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C042"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19874.1"
FT                   /translation="MMAQQLLLPAANEQQIEAKIEAILASRQHCNASGQAGEDVHLIRA
FT                   QLSQKSQESGTAHESVLATNHLTAKQSET"
     MMAQQLLLPA ANEQQIEAKI EAILASRQHC NASGQAGEDV HLIRAQLSQK SQESGTAHES        60
     VLATNHLTAK QSET                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page