(data stored in ACNUC9435 zone)

EMBL: AM039951.PE63

AM039951.PE63        Location/Qualifiers
FT   CDS             complement(72868..73266)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19875.1"
FT                   /translation="MSENSQHQVIRNAPAPVIAHGQDNPAPNITPAALAQRLNRYADEL
FT                   SEVGRAYSATLLRAAACAISELLKAKAQAANSTAVPERRDELELQSSEQRSYNSGWNAC
FT                   RAAMLGSHTLPPVQCVDLPEAITAAATK"
     MSENSQHQVI RNAPAPVIAH GQDNPAPNIT PAALAQRLNR YADELSEVGR AYSATLLRAA        60
     ACAISELLKA KAQAANSTAV PERRDELELQ SSEQRSYNSG WNACRAAMLG SHTLPPVQCV       120
     DLPEAITAAA TK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page