(data stored in ACNUC9435 zone)

EMBL: AM039951.PE64

AM039951.PE64        Location/Qualifiers
FT   CDS             complement(73687..74136)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19876.1"
FT                   /translation="MAAKLEIEKEREAVARAVCLACEEVPDHIGDAQGNAHRWQDYLPC
FT                   ADAAIAAFTSHEKGQQASHAVPPAAAPVQVEVLHVSGVPEACKHCGGTAFEWFAHKRAA
FT                   SDVVDGRLRTHEVQCSFVLGCLDCSETLMVVAADTIAGMLSTRSQ"
     MAAKLEIEKE REAVARAVCL ACEEVPDHIG DAQGNAHRWQ DYLPCADAAI AAFTSHEKGQ        60
     QASHAVPPAA APVQVEVLHV SGVPEACKHC GGTAFEWFAH KRAASDVVDG RLRTHEVQCS       120
     FVLGCLDCSE TLMVVAADTI AGMLSTRSQ                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page