(data stored in ACNUC9435 zone)

EMBL: AM039951.PE65

AM039951.PE65        Location/Qualifiers
FT   CDS             complement(74216..74692)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19877"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19877.1"
FT                   /translation="MATDESSIEPDIFLLQAVVNGEAWEHSWYVPRWGDPDPRRLDGAV
FT                   YEIDGRKIPNLGVYRVKGFYAEPKVPAVLPVDEQRDAERFRWLCDFAINHEEIDRGTPY
FT                   VVYGIGMGDCEPAVASEIRDMIDAAMARDKHWIAAQLQRTDGDKDAKATKAAKA"
     MATDESSIEP DIFLLQAVVN GEAWEHSWYV PRWGDPDPRR LDGAVYEIDG RKIPNLGVYR        60
     VKGFYAEPKV PAVLPVDEQR DAERFRWLCD FAINHEEIDR GTPYVVYGIG MGDCEPAVAS       120
     EIRDMIDAAM ARDKHWIAAQ LQRTDGDKDA KATKAAKA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page