(data stored in ACNUC9435 zone)

EMBL: AM039951.PE67

AM039951.PE67        Location/Qualifiers
FT   CDS             complement(74906..75220)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19879.1"
FT                   /translation="MTAVVAYWVAIAREHHRWAADTRAQLQDCRRHGLADRRKQLRKEL
FT                   QRQRDRRALAMVKARLTRDEVARVDALRLAELAHLTAGLVPGLTMGGRPVLAISSETSP
FT                   "
     MTAVVAYWVA IAREHHRWAA DTRAQLQDCR RHGLADRRKQ LRKELQRQRD RRALAMVKAR        60
     LTRDEVARVD ALRLAELAHL TAGLVPGLTM GGRPVLAISS ETSP                        104
//

If you have problems or comments...

PBIL Back to PBIL home page