(data stored in ACNUC9435 zone)

EMBL: AM039951.PE69

AM039951.PE69        Location/Qualifiers
FT   CDS             complement(76136..76408)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19881.1"
FT                   /translation="MTLPDERTRNLLQAGAFLKELAGSQAVPKSVRQEAYRLLRHYPTL
FT                   SDVEAIAQHEERLRDLTQSSFVRPYLTSQFEEDWFRGYPKGPHRT"
     MTLPDERTRN LLQAGAFLKE LAGSQAVPKS VRQEAYRLLR HYPTLSDVEA IAQHEERLRD        60
     LTQSSFVRPY LTSQFEEDWF RGYPKGPHRT                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page