(data stored in ACNUC9435 zone)

EMBL: AM039951.PE70

AM039951.PE70        Location/Qualifiers
FT   CDS             complement(76556..77497)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0070"
FT                   /product="putative cointegrate resolution protein T"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19882"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19882.1"
FT                   /translation="MTRGITESDVHGAADALVADGERPTVERIRAYLGTGSPNTVVRWL
FT                   ETWWQCLGSRLATDRQVRIATANVPEAVAALAGQWWTLALDHARAQADDAMASDRASLL
FT                   DARETLERDRHAMQAELARLESVTHAAQQAEQLAAARTSELERFVEQLQRQLAELSQQR
FT                   DASALRALGAESANEMLRVQLQELQDAARAERDTLTQHMRANEDRAHAEIDHARQESKQ
FT                   AKQQLAASQREAALDKRRLEEALEHAQGDVSALRQDLTIQQARADALEAQLVKLNDLPA
FT                   ALEAAWQQHVGRSPPKRPKPERSKRDRSKAVT"
     MTRGITESDV HGAADALVAD GERPTVERIR AYLGTGSPNT VVRWLETWWQ CLGSRLATDR        60
     QVRIATANVP EAVAALAGQW WTLALDHARA QADDAMASDR ASLLDARETL ERDRHAMQAE       120
     LARLESVTHA AQQAEQLAAA RTSELERFVE QLQRQLAELS QQRDASALRA LGAESANEML       180
     RVQLQELQDA ARAERDTLTQ HMRANEDRAH AEIDHARQES KQAKQQLAAS QREAALDKRR       240
     LEEALEHAQG DVSALRQDLT IQQARADALE AQLVKLNDLP AALEAAWQQH VGRSPPKRPK       300
     PERSKRDRSK AVT                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page