(data stored in ACNUC9435 zone)

EMBL: AM039951.PE71

AM039951.PE71        Location/Qualifiers
FT   CDS             77603..78688
FT                   /transl_table=11
FT                   /locus_tag="XCVd0071"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19883"
FT                   /db_xref="GOA:Q3C033"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19883.1"
FT                   /translation="MKDNSTSSALAQTVQHLVLPEQLAQQAADAVRELLAEAAAANTTR
FT                   SYASALRYWAGWHAARYGIELALPVPEATVLQFVIDHVQRRSTDGELAWELPPMVDQAL
FT                   VAAGLKAKLGPWTLATVRHRVAVLSTAHRLKQVANPCEQPAIRTVLSRAARAAVKRGER
FT                   PRKKTAITLPELEAMLATCDDSLEGIRDRALLCFGFASGGRRRSEIAAADLRDLRRIGE
FT                   AGYIYRLEHSKTQQAGVTVSSTPDKPVLDRAALALEVWLEASGITEGAIFRRLWKQRVG
FT                   PALSPAAVGEIVQRRARLAALEGDFGGHSLRSGFVTEASRQGVALPAIMQLTEHRAVAS
FT                   VIGYFQTGGAAANPAARLLED"
     MKDNSTSSAL AQTVQHLVLP EQLAQQAADA VRELLAEAAA ANTTRSYASA LRYWAGWHAA        60
     RYGIELALPV PEATVLQFVI DHVQRRSTDG ELAWELPPMV DQALVAAGLK AKLGPWTLAT       120
     VRHRVAVLST AHRLKQVANP CEQPAIRTVL SRAARAAVKR GERPRKKTAI TLPELEAMLA       180
     TCDDSLEGIR DRALLCFGFA SGGRRRSEIA AADLRDLRRI GEAGYIYRLE HSKTQQAGVT       240
     VSSTPDKPVL DRAALALEVW LEASGITEGA IFRRLWKQRV GPALSPAAVG EIVQRRARLA       300
     ALEGDFGGHS LRSGFVTEAS RQGVALPAIM QLTEHRAVAS VIGYFQTGGA AANPAARLLE       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page