(data stored in ACNUC9435 zone)

EMBL: AM039951.PE72

AM039951.PE72        Location/Qualifiers
FT   CDS             78912..80369
FT                   /transl_table=11
FT                   /locus_tag="XCVd0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19884"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19884.1"
FT                   /translation="MEAGHKSTGVTDTERMLADFCERSFLKLWTYPNPYKEDGKELCDV
FT                   LAVFGDHIFVFFDREKAYSQTPDADPLIAWDRWKRRAIDRQIITAHGAERYLRSGRPIF
FT                   LDAKQTVRFPLEVNRAATVHKIVVAHGAKDACARSSEQNIYGSLAITYCDLDQGHQPRP
FT                   FHVELDRQDPVHLFDSHNLPIVLGELDTISDFSRYLDEKVRAIRRFDVLAYCGAEDLLG
FT                   HYLLNFDQTTNVHRIGFDEPVNGVMIGEGEWHGLVNSALYQNTKREDEVSYFWDELIQR
FT                   TCQNLLDGTLGGNADLLRGQSAIVEMVKEPRFVRRALSSKIRENVINFPDTGGLTRLVS
FT                   LMPSFDPEVGYVFFQLRAPEAIRAQLDYLDKRRTLLEIACGAARNKFPHLRKVIGIGMD
FT                   APKFAGDTNSEDFILMPCEAWPDDVRDHYQALNEDWRFFDTPQLQQYEQTVTQFVPPNE
FT                   AFVGKKVGRNEPCPCGLGKKYKKCHGA"
     MEAGHKSTGV TDTERMLADF CERSFLKLWT YPNPYKEDGK ELCDVLAVFG DHIFVFFDRE        60
     KAYSQTPDAD PLIAWDRWKR RAIDRQIITA HGAERYLRSG RPIFLDAKQT VRFPLEVNRA       120
     ATVHKIVVAH GAKDACARSS EQNIYGSLAI TYCDLDQGHQ PRPFHVELDR QDPVHLFDSH       180
     NLPIVLGELD TISDFSRYLD EKVRAIRRFD VLAYCGAEDL LGHYLLNFDQ TTNVHRIGFD       240
     EPVNGVMIGE GEWHGLVNSA LYQNTKREDE VSYFWDELIQ RTCQNLLDGT LGGNADLLRG       300
     QSAIVEMVKE PRFVRRALSS KIRENVINFP DTGGLTRLVS LMPSFDPEVG YVFFQLRAPE       360
     AIRAQLDYLD KRRTLLEIAC GAARNKFPHL RKVIGIGMDA PKFAGDTNSE DFILMPCEAW       420
     PDDVRDHYQA LNEDWRFFDT PQLQQYEQTV TQFVPPNEAF VGKKVGRNEP CPCGLGKKYK       480
     KCHGA                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page