(data stored in ACNUC9435 zone)

EMBL: AM039951.PE73

AM039951.PE73        Location/Qualifiers
FT   CDS             80410..81795
FT                   /transl_table=11
FT                   /locus_tag="XCVd0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19885"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19885.1"
FT                   /translation="MHTISLPRFNALAAWCRFGPTMWILDEIAWFEAADGKLLGVIVRD
FT                   HTDGDFLGIYLAQDRVGRFRHISQTDAFFDTAEAAAAALVAGAPALLARLEAERGQGDE
FT                   EPAPVDFFRLEVARERLHPSFATLLDKEGFSPARAIVEAMMRWYEDVDGNFIEQFQTGG
FT                   FDARLLELYAYALLVENNFSLSREHAAPDFLAEDILGTIAVEVTTVNPTQDRQGNPQPP
FT                   PKITSEDERLAYLKHYIPIKFAGALKRKLGKAYWEMPHVAGKPLVFIIQDFHAAASMTF
FT                   ARTGLINYLYGYEHNAIQDAEGRLVVVATKVTEHRWGGRAAESGFFDLPGAEHVSAVIF
FT                   NSGATLSKFNRIGYVAGFGSRRVRMIRHGTVWNPDPDAAEPIPFAVRVDDPDYAESWTE
FT                   GLDVFHNPRAAIPLNPEHFPAAVHHYLLPDGNINSVQAGGLVQPLASMTNIYILETADV
FT                   KAL"
     MHTISLPRFN ALAAWCRFGP TMWILDEIAW FEAADGKLLG VIVRDHTDGD FLGIYLAQDR        60
     VGRFRHISQT DAFFDTAEAA AAALVAGAPA LLARLEAERG QGDEEPAPVD FFRLEVARER       120
     LHPSFATLLD KEGFSPARAI VEAMMRWYED VDGNFIEQFQ TGGFDARLLE LYAYALLVEN       180
     NFSLSREHAA PDFLAEDILG TIAVEVTTVN PTQDRQGNPQ PPPKITSEDE RLAYLKHYIP       240
     IKFAGALKRK LGKAYWEMPH VAGKPLVFII QDFHAAASMT FARTGLINYL YGYEHNAIQD       300
     AEGRLVVVAT KVTEHRWGGR AAESGFFDLP GAEHVSAVIF NSGATLSKFN RIGYVAGFGS       360
     RRVRMIRHGT VWNPDPDAAE PIPFAVRVDD PDYAESWTEG LDVFHNPRAA IPLNPEHFPA       420
     AVHHYLLPDG NINSVQAGGL VQPLASMTNI YILETADVKA L                           461
//

If you have problems or comments...

PBIL Back to PBIL home page