(data stored in ACNUC9435 zone)

EMBL: AM039951.PE75

AM039951.PE75        Location/Qualifiers
FT   CDS             83244..85442
FT                   /transl_table=11
FT                   /locus_tag="XCVd0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19887"
FT                   /db_xref="GOA:Q3C029"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19887.1"
FT                   /translation="MAPTPRNTLIANGQALIGDLAWPTGGGPKWHPYDIAVQRDVLHPQ
FT                   LTAVARAAREVSRVYSPRGEVTARLTLHPTFLAKTHFPAHILRDAGLTVLGSRATQVTP
FT                   RVSQGDKQGPQDTAEILVAGTPEGFEAMDRQLGDPAIAKGRQEEFTHIESVLTYAGESK
FT                   LRLDPDTPWPDFVHVTLHAGEHDADLLTAFQTFTLQLGGEISARGFRFVPGLAFVAVQL
FT                   PADSVPELARFERIRLVRSMPRLREQLDLTAALTRKFPTLVLPASRLTAPGPRVAVFDG
FT                   GTQNSFGAHVVELAAPGLPPATVADLAHGVNVTSALLFGPVDPSHTALSAPPWMVEHHR
FT                   VLPTNDSPEQALDVLDRIVTALRIARTADRPYRFANISLGPVATFFDDDIHEWTSRLDT
FT                   ELADGRTLCTAAVGNNGALDGELGRIQPPGDAVNLFAIGAADTRHPKWNRAPYSATGPG
FT                   RSPGFVKPDVLAFGGSPAEPMPVYSPLAGGVVAVGGTSFASPLALRTALGVDVLSQSRF
FT                   DPITLQALLINAAECRRGHKRTDVGWGRIPLGPDAIVHTPLDVVRVVYQGITHPGHPQK
FT                   AVIPVPRGLPAGTRVRIGATFCYRAQVDSAHAINYTRAGLWVRCYKAPGQSLPLFGSGM
FT                   YKSEEELRRDAMRWDTVLNNACTVDAAELDAPYFHINYQVRDESEAVRWEDAVPMPYAL
FT                   IVTLQAPGVADLMTRVQAEFPVLQTLPVEVQVPVDGLS"
     MAPTPRNTLI ANGQALIGDL AWPTGGGPKW HPYDIAVQRD VLHPQLTAVA RAAREVSRVY        60
     SPRGEVTARL TLHPTFLAKT HFPAHILRDA GLTVLGSRAT QVTPRVSQGD KQGPQDTAEI       120
     LVAGTPEGFE AMDRQLGDPA IAKGRQEEFT HIESVLTYAG ESKLRLDPDT PWPDFVHVTL       180
     HAGEHDADLL TAFQTFTLQL GGEISARGFR FVPGLAFVAV QLPADSVPEL ARFERIRLVR       240
     SMPRLREQLD LTAALTRKFP TLVLPASRLT APGPRVAVFD GGTQNSFGAH VVELAAPGLP       300
     PATVADLAHG VNVTSALLFG PVDPSHTALS APPWMVEHHR VLPTNDSPEQ ALDVLDRIVT       360
     ALRIARTADR PYRFANISLG PVATFFDDDI HEWTSRLDTE LADGRTLCTA AVGNNGALDG       420
     ELGRIQPPGD AVNLFAIGAA DTRHPKWNRA PYSATGPGRS PGFVKPDVLA FGGSPAEPMP       480
     VYSPLAGGVV AVGGTSFASP LALRTALGVD VLSQSRFDPI TLQALLINAA ECRRGHKRTD       540
     VGWGRIPLGP DAIVHTPLDV VRVVYQGITH PGHPQKAVIP VPRGLPAGTR VRIGATFCYR       600
     AQVDSAHAIN YTRAGLWVRC YKAPGQSLPL FGSGMYKSEE ELRRDAMRWD TVLNNACTVD       660
     AAELDAPYFH INYQVRDESE AVRWEDAVPM PYALIVTLQA PGVADLMTRV QAEFPVLQTL       720
     PVEVQVPVDG LS                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page