(data stored in ACNUC9435 zone)

EMBL: AM039951.PE76

AM039951.PE76        Location/Qualifiers
FT   CDS             85510..85761
FT                   /transl_table=11
FT                   /locus_tag="XCVd0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19888"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19888.1"
FT                   /translation="MAKKHESSGPKVTRTASSVLRDSGASKTAKSLAGSTLAQAGTRKV
FT                   SSATTARTAAKALNDGRTSAGTKALAGSVLTQRPGKRK"
     MAKKHESSGP KVTRTASSVL RDSGASKTAK SLAGSTLAQA GTRKVSSATT ARTAAKALND        60
     GRTSAGTKAL AGSVLTQRPG KRK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page