(data stored in ACNUC9435 zone)

EMBL: AM039951.PE78

AM039951.PE78        Location/Qualifiers
FT   CDS             86685..87308
FT                   /transl_table=11
FT                   /locus_tag="XCVd0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19890.1"
FT                   /translation="MTSPNRRLSLEDVLDALFLRDDAPTPEMIVQACQAHAEFREEILE
FT                   FAALQAAQAALPDVAESDLEVSDASVMRLQSHVLNLLYGAPPTRADADAVRQAVRSLAG
FT                   QRLQAAAQAIDLGSTVLLHKVLTRAIIDTPRVVFVRLAQFLKVGVDGLVDALGPQLALH
FT                   RSYKAADKPTMVKQESWEQAVAALAVDEAEKARLRAMQDRSDPA"
     MTSPNRRLSL EDVLDALFLR DDAPTPEMIV QACQAHAEFR EEILEFAALQ AAQAALPDVA        60
     ESDLEVSDAS VMRLQSHVLN LLYGAPPTRA DADAVRQAVR SLAGQRLQAA AQAIDLGSTV       120
     LLHKVLTRAI IDTPRVVFVR LAQFLKVGVD GLVDALGPQL ALHRSYKAAD KPTMVKQESW       180
     EQAVAALAVD EAEKARLRAM QDRSDPA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page