(data stored in ACNUC9435 zone)

EMBL: AM039951.PE80

AM039951.PE80        Location/Qualifiers
FT   CDS             90720..91226
FT                   /transl_table=11
FT                   /locus_tag="XCVd0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19892"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19892.1"
FT                   /translation="MSTIRVYVQSEHFSNIKLVEVDDHATIADLKRAALTLLPAGTDPT
FT                   GLSLSIEDDDVDDDEAASKRRLKDLNPDRGVRVHLHRCKQVAVTVRFGGRSEEHPFRPA
FT                   TTIGRIRQWAGRRFGLKAGDIAEHVLQIAGSNEQPDMDTHVGTLVQHPRCAIVFDLVPA
FT                   HRING"
     MSTIRVYVQS EHFSNIKLVE VDDHATIADL KRAALTLLPA GTDPTGLSLS IEDDDVDDDE        60
     AASKRRLKDL NPDRGVRVHL HRCKQVAVTV RFGGRSEEHP FRPATTIGRI RQWAGRRFGL       120
     KAGDIAEHVL QIAGSNEQPD MDTHVGTLVQ HPRCAIVFDL VPAHRING                    168
//

If you have problems or comments...

PBIL Back to PBIL home page