(data stored in ACNUC9435 zone)

EMBL: AM039951.PE82

AM039951.PE82        Location/Qualifiers
FT   CDS             91677..92168
FT                   /transl_table=11
FT                   /locus_tag="XCVd0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19894"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19894.1"
FT                   /translation="MNAPQLEIAPTLWSAILAHLRQQGAGVRESGGFLLGRVRNGVRVV
FT                   TGFLPYEQLQADALQADFVHLSSASFSRLWDYCATHGLEVVADVHTHRYGAGQSRSDSE
FT                   NPMLAIAGHVALIVPEFAQGPTGFEHLGLYVYQGAHRWARYRGAAVAQVLKFTPPEGER
FT                   "
     MNAPQLEIAP TLWSAILAHL RQQGAGVRES GGFLLGRVRN GVRVVTGFLP YEQLQADALQ        60
     ADFVHLSSAS FSRLWDYCAT HGLEVVADVH THRYGAGQSR SDSENPMLAI AGHVALIVPE       120
     FAQGPTGFEH LGLYVYQGAH RWARYRGAAV AQVLKFTPPE GER                         163
//

If you have problems or comments...

PBIL Back to PBIL home page