(data stored in ACNUC9435 zone)

EMBL: AM039951.PE83

AM039951.PE83        Location/Qualifiers
FT   CDS             92165..93523
FT                   /transl_table=11
FT                   /locus_tag="XCVd0083"
FT                   /product="UBA/ThiF-type NAD/FAD binding fold containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19895"
FT                   /db_xref="GOA:Q3C021"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19895.1"
FT                   /translation="MTLFDADAMHRLAKLALDAGEVTTPDAALELFRQYRLRIHLGTGW
FT                   ANTLAGQACVLTAVSTASRALLGGVEVTGDLTPVMQVPLFAGQRAADVVAALGGAATAM
FT                   PTPRLPSLMIGDGPPPEGVALTLRPSWDGWCAQVAPADSDDHLTVGDDNPLAGVCAGAL
FT                   AVSEVFSHVRADSPEAGYRRIGLSLWNPLAIEDWNAPENRGPALAYLPTDLWLIGIGHL
FT                   GQAYAWGLAMLPYPAQRRPRLVLQDVDRVTESNLSTCLLVGADDVTARKTRVMARRLEA
FT                   IGFDIDLVDRRFGAQHLLQPGEPTVALFGVDNVAARRDLDTAAFVLIVEAGLGSGYRDF
FT                   RNLRLHTFPGPRPATELWPAQAASQPLTELNTAYQQLAHDSGDLCGVTMLASKAVATPF
FT                   VGAFAASLALAELVRPLHGGCVHASLDCPLRSLTHRLGEPTPANARCAFIALP"
     MTLFDADAMH RLAKLALDAG EVTTPDAALE LFRQYRLRIH LGTGWANTLA GQACVLTAVS        60
     TASRALLGGV EVTGDLTPVM QVPLFAGQRA ADVVAALGGA ATAMPTPRLP SLMIGDGPPP       120
     EGVALTLRPS WDGWCAQVAP ADSDDHLTVG DDNPLAGVCA GALAVSEVFS HVRADSPEAG       180
     YRRIGLSLWN PLAIEDWNAP ENRGPALAYL PTDLWLIGIG HLGQAYAWGL AMLPYPAQRR       240
     PRLVLQDVDR VTESNLSTCL LVGADDVTAR KTRVMARRLE AIGFDIDLVD RRFGAQHLLQ       300
     PGEPTVALFG VDNVAARRDL DTAAFVLIVE AGLGSGYRDF RNLRLHTFPG PRPATELWPA       360
     QAASQPLTEL NTAYQQLAHD SGDLCGVTML ASKAVATPFV GAFAASLALA ELVRPLHGGC       420
     VHASLDCPLR SLTHRLGEPT PANARCAFIA LP                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page