(data stored in ACNUC9435 zone)

EMBL: AM039951.PE84

AM039951.PE84        Location/Qualifiers
FT   CDS             93531..94070
FT                   /transl_table=11
FT                   /locus_tag="XCVd0084"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19896"
FT                   /db_xref="GOA:Q3C020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19896.1"
FT                   /translation="MKSSRHSNRHVSVADNTSAPTTWVERKLMFLQAYKGECGVAYLLG
FT                   VLGVFAPTTVALFIIDRPAYLAMGWSQSLLVVGAVGGMVTALLMCGLVIQAVAERRTPA
FT                   SAYERQRLMRDTLVCGSVMAMFAQFAGLTVALTSRMDIPSYAYTVLLIAVGYATAQGAS
FT                   ALLTRARQKVLARIGR"
     MKSSRHSNRH VSVADNTSAP TTWVERKLMF LQAYKGECGV AYLLGVLGVF APTTVALFII        60
     DRPAYLAMGW SQSLLVVGAV GGMVTALLMC GLVIQAVAER RTPASAYERQ RLMRDTLVCG       120
     SVMAMFAQFA GLTVALTSRM DIPSYAYTVL LIAVGYATAQ GASALLTRAR QKVLARIGR        179
//

If you have problems or comments...

PBIL Back to PBIL home page