(data stored in ACNUC9435 zone)

EMBL: AM039951.PE85

AM039951.PE85        Location/Qualifiers
FT   CDS             complement(94208..94690)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19897"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19897.1"
FT                   /translation="MPWQNDLRRTSRDAVVAERVIVAVEQLLERDRHLFVHRVGERAIS
FT                   HRLAIYVEAQFPGWDVDCEYDRDNAARKMIPDGTGNDDDEGSAVLPDIIVHRRGPGENH
FT                   VVFELKKSSNRLPDDRDLEKLRAYGRHLGYAHGVFIRFVVGEPNPDISRAEFIYGD"
     MPWQNDLRRT SRDAVVAERV IVAVEQLLER DRHLFVHRVG ERAISHRLAI YVEAQFPGWD        60
     VDCEYDRDNA ARKMIPDGTG NDDDEGSAVL PDIIVHRRGP GENHVVFELK KSSNRLPDDR       120
     DLEKLRAYGR HLGYAHGVFI RFVVGEPNPD ISRAEFIYGD                             160
//

If you have problems or comments...

PBIL Back to PBIL home page