(data stored in ACNUC9435 zone)

EMBL: AM039951.PE86

AM039951.PE86        Location/Qualifiers
FT   CDS             94907..96058
FT                   /transl_table=11
FT                   /locus_tag="XCVd0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19898.1"
FT                   /translation="MGSGGLARQGPGSGDIAQLNSAASLFLQVPMRITNDNYSPIELLA
FT                   EIATRRGTTSADTHRFFQGGKTSHDWLVEEWSSRVDCILESFKRYGIDVNATQFVRDQG
FT                   IDVLLRVPNHQGKEWRLGFQIKSEQEAERDRTKKPGQENMIGTLKRQAHDAFERVDEWW
FT                   ILCCFDLDKHYKLVQGISSELTGGKQNRLIRVIDPRACAAMLRMSEAEVDAFCTLLLCR
FT                   DDAVLRAAREEVAACHPNVGAFVLEHIVPALVDGERVSREEVASFLEEAFRKSERERLE
FT                   DGGGEDDDCEAVIELDEDADEHGSVQDGIDDDEEFEDLDIHEMLQELESNGFLAAGTYD
FT                   DDYRISPTAFPGVCALFFEARVRHGLNDDAAASYMRWLTLRQH"
     MGSGGLARQG PGSGDIAQLN SAASLFLQVP MRITNDNYSP IELLAEIATR RGTTSADTHR        60
     FFQGGKTSHD WLVEEWSSRV DCILESFKRY GIDVNATQFV RDQGIDVLLR VPNHQGKEWR       120
     LGFQIKSEQE AERDRTKKPG QENMIGTLKR QAHDAFERVD EWWILCCFDL DKHYKLVQGI       180
     SSELTGGKQN RLIRVIDPRA CAAMLRMSEA EVDAFCTLLL CRDDAVLRAA REEVAACHPN       240
     VGAFVLEHIV PALVDGERVS REEVASFLEE AFRKSERERL EDGGGEDDDC EAVIELDEDA       300
     DEHGSVQDGI DDDEEFEDLD IHEMLQELES NGFLAAGTYD DDYRISPTAF PGVCALFFEA       360
     RVRHGLNDDA AASYMRWLTL RQH                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page