(data stored in ACNUC9435 zone)

EMBL: AM039951.PE87

AM039951.PE87        Location/Qualifiers
FT   CDS             96358..98460
FT                   /transl_table=11
FT                   /locus_tag="XCVd0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19899.1"
FT                   /translation="MNLEAFRQIVDSAGPGIAVCADDLQRLYEYVGLEGRGSYTRKAVS
FT                   DALYASIRSCFTSGHSAVWRACKSLRRDLIREHVLLGVSLDPYFDVLDHLQDAVRTDGA
FT                   SRASIEGDWNQAIRAALDHVQIHSRDQMNRTMLHARDFQVAEAARTLRDAGFSIRLEAG
FT                   RLGLEETSETALVAAIEDLSAAMGGINVARRIFNAISPHYDVDQQRYHVVRRTSMIGGG
FT                   LAQMPWGYMLQLAAKHARGRKPYKNNDDQWRMLCGLSQAYAAIFDVQPYTPTIYGTMDA
FT                   TGLVPYLQEMAIYDTLFRIPQMRPTDVVKIARGMFSWLDTSVPTKGGWSINHVLEIIDY
FT                   LLDPGRNARGPIFVTESDIRRSCSHIPREIVTQILSEVLSHPLSGANQNFSRPTDAPAP
FT                   EGPNVKSAGHDFFLRPLLRMSDQQFSLLDRSVCAPAFLEAMLTPLRAEIKGLDDKIGVA
FT                   IERFLEAEFASHGVPTGGGDYDVGGNHGECDLIIEMPDTVIFSEVKKKTLTRRAKAGSD
FT                   AHLLVDLANSLLVAQVQAGWHEVRLRQHGHLDLERNGTVMRLELNDRQVERVAVSLFDF
FT                   GSFQDRILLKQFLEATMYATFTPTALNLQSKFAEINAALIEIRDQVVALYPGQNEINQP
FT                   FFNCWFVSVPQLLVLLDGVTNAAGFKRALWSCRHFVTGSSDLYFDLSYRRQLERETAAN
FT                   PVTPAV"
     MNLEAFRQIV DSAGPGIAVC ADDLQRLYEY VGLEGRGSYT RKAVSDALYA SIRSCFTSGH        60
     SAVWRACKSL RRDLIREHVL LGVSLDPYFD VLDHLQDAVR TDGASRASIE GDWNQAIRAA       120
     LDHVQIHSRD QMNRTMLHAR DFQVAEAART LRDAGFSIRL EAGRLGLEET SETALVAAIE       180
     DLSAAMGGIN VARRIFNAIS PHYDVDQQRY HVVRRTSMIG GGLAQMPWGY MLQLAAKHAR       240
     GRKPYKNNDD QWRMLCGLSQ AYAAIFDVQP YTPTIYGTMD ATGLVPYLQE MAIYDTLFRI       300
     PQMRPTDVVK IARGMFSWLD TSVPTKGGWS INHVLEIIDY LLDPGRNARG PIFVTESDIR       360
     RSCSHIPREI VTQILSEVLS HPLSGANQNF SRPTDAPAPE GPNVKSAGHD FFLRPLLRMS       420
     DQQFSLLDRS VCAPAFLEAM LTPLRAEIKG LDDKIGVAIE RFLEAEFASH GVPTGGGDYD       480
     VGGNHGECDL IIEMPDTVIF SEVKKKTLTR RAKAGSDAHL LVDLANSLLV AQVQAGWHEV       540
     RLRQHGHLDL ERNGTVMRLE LNDRQVERVA VSLFDFGSFQ DRILLKQFLE ATMYATFTPT       600
     ALNLQSKFAE INAALIEIRD QVVALYPGQN EINQPFFNCW FVSVPQLLVL LDGVTNAAGF       660
     KRALWSCRHF VTGSSDLYFD LSYRRQLERE TAANPVTPAV                             700
//

If you have problems or comments...

PBIL Back to PBIL home page