(data stored in ACNUC9435 zone)

EMBL: AM039951.PE89

AM039951.PE89        Location/Qualifiers
FT   CDS             complement(98928..99539)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19901.1"
FT                   /translation="MARGAISADECFVGYVPPTGIVSSPSRSICVDEVARWVRACRDRS
FT                   IVGCTYQSMEEEGPKAVRLSPHALGFDGLRWHIRAYCHERMIFRDFAIGRLGIQIVEEG
FT                   DSHVDPREDVGWTTLVEVVLVPHPKLGRLQREAVARDYGMSSDRHVLTCQKAMLFYTLR
FT                   HLNLESLSVSERAAEQHVIVENVEQVKRWMEEDRAGIQGL"
     MARGAISADE CFVGYVPPTG IVSSPSRSIC VDEVARWVRA CRDRSIVGCT YQSMEEEGPK        60
     AVRLSPHALG FDGLRWHIRA YCHERMIFRD FAIGRLGIQI VEEGDSHVDP REDVGWTTLV       120
     EVVLVPHPKL GRLQREAVAR DYGMSSDRHV LTCQKAMLFY TLRHLNLESL SVSERAAEQH       180
     VIVENVEQVK RWMEEDRAGI QGL                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page