(data stored in ACNUC9435 zone)

EMBL: AM039951.PE9

AM039951.PE9         Location/Qualifiers
FT   CDS             9367..9798
FT                   /transl_table=11
FT                   /locus_tag="XCVd0009"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19821"
FT                   /db_xref="GOA:Q3C095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C095"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19821.1"
FT                   /translation="MNPRRKATINWGIFTMKVLAIFALGVGAISVRSTTDTVGMLLDQT
FT                   GAQVQFMQKLVETNDPALAETAFKYGREVIGSFDATALTQQVLAVYALAAITGVFAIFI
FT                   LLGLPSIDRAGHGKSRWSLRKTSVPNDMKSTPSDGNSND"
     MNPRRKATIN WGIFTMKVLA IFALGVGAIS VRSTTDTVGM LLDQTGAQVQ FMQKLVETND        60
     PALAETAFKY GREVIGSFDA TALTQQVLAV YALAAITGVF AIFILLGLPS IDRAGHGKSR       120
     WSLRKTSVPN DMKSTPSDGN SND                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page