(data stored in ACNUC9435 zone)

EMBL: AM039951.PE92

AM039951.PE92        Location/Qualifiers
FT   CDS             complement(100891..101652)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0092"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19904.1"
FT                   /translation="MGASNQTACAVPEAGVIILQLSGGWARFGCFLYQSLPTLVLQAER
FT                   EAGDAARGEVARRTTELAQLEERIAGLTARLAEHQSHARSLEQKHDHAREALEHYRTSV
FT                   KDQREQEQRRHEHQVQELQVALRQANEALTAKNHDLMQLNRENGQWLERHTRLERELTQ
FT                   TRQRADAQQRERDALRLAAAEHQGLQARWTKDVQALEGVRAELAAASALRWRTRKRHRS
FT                   RCNARRQMISRLAKARESSASVPSSSQPGFR"
     MGASNQTACA VPEAGVIILQ LSGGWARFGC FLYQSLPTLV LQAEREAGDA ARGEVARRTT        60
     ELAQLEERIA GLTARLAEHQ SHARSLEQKH DHAREALEHY RTSVKDQREQ EQRRHEHQVQ       120
     ELQVALRQAN EALTAKNHDL MQLNRENGQW LERHTRLERE LTQTRQRADA QQRERDALRL       180
     AAAEHQGLQA RWTKDVQALE GVRAELAAAS ALRWRTRKRH RSRCNARRQM ISRLAKARES       240
     SASVPSSSQP GFR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page