(data stored in ACNUC9435 zone)

EMBL: AM039951.PE93

AM039951.PE93        Location/Qualifiers
FT   CDS             101887..102924
FT                   /transl_table=11
FT                   /locus_tag="XCVd0093"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19905"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19905.1"
FT                   /translation="MRKFKSKYMLGACIVGSIVSAGAAAQVAAINNTGRAEAMSAWETT
FT                   LKHEAPAMEGCFSSTFPDMGWQAVRCGAPPKLVMKPRHVASGNVRTTTDNRVLITGNGD
FT                   DYAARTGRLTHSAVGSFPSVSGVTTGVVQYSLQINTDNDSNPAACAQFGFSSCKTWQQY
FT                   VYSSDADEDSSNGFDPVIFIESWVYADSTSEYDAAGCPSGWDAYEGNACVINSESVRVP
FT                   LVPVSGIAGVKLTGSATSGGVDTVSFSVNGRAYSVSQRASTVDINKIWRLTEFNIFGNG
FT                   ARTQTVSFNRGSHVTVNVAVNDGTTNAPTCLGNAGQTFEQNNLTRGSCSVFGGASPGIS
FT                   FPQSN"
     MRKFKSKYML GACIVGSIVS AGAAAQVAAI NNTGRAEAMS AWETTLKHEA PAMEGCFSST        60
     FPDMGWQAVR CGAPPKLVMK PRHVASGNVR TTTDNRVLIT GNGDDYAART GRLTHSAVGS       120
     FPSVSGVTTG VVQYSLQINT DNDSNPAACA QFGFSSCKTW QQYVYSSDAD EDSSNGFDPV       180
     IFIESWVYAD STSEYDAAGC PSGWDAYEGN ACVINSESVR VPLVPVSGIA GVKLTGSATS       240
     GGVDTVSFSV NGRAYSVSQR ASTVDINKIW RLTEFNIFGN GARTQTVSFN RGSHVTVNVA       300
     VNDGTTNAPT CLGNAGQTFE QNNLTRGSCS VFGGASPGIS FPQSN                       345
//

If you have problems or comments...

PBIL Back to PBIL home page