(data stored in ACNUC9435 zone)

EMBL: AM039951.PE94

AM039951.PE94        Location/Qualifiers
FT   CDS             complement(102912..103979)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0094"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19906"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BTA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19906.1"
FT                   /translation="MARSGLYKSDVQRARDSLRATGKNPSVDAVRVALGNTGSKTTIHR
FT                   YLRELEEEEGQGVGAKMAVSDALQDLVARLAERLHGEADTVVAQAQARFQAQLQERTQT
FT                   LEQARQEADSLTTQLQRCETVLQAECEASATARSEVASRTTELAQLEERIAGLTARLAE
FT                   HQSHARSLEQKHDHAREALEHYRTSVKDQREQEQRRHEHQVQELQVALRQANEALTAKN
FT                   HDLMQLNRENGQWLERHTRLERELTQTRQRADAQQRERDALRLAAAEHQGLQARWTKDV
FT                   QALEGVRAELAAVRTDLIEERQRREHAEADTLRATVRLSTLEQLLAQLRPPRPVGEQVT
FT                   SGKDETSPDANSQLL"
     MARSGLYKSD VQRARDSLRA TGKNPSVDAV RVALGNTGSK TTIHRYLREL EEEEGQGVGA        60
     KMAVSDALQD LVARLAERLH GEADTVVAQA QARFQAQLQE RTQTLEQARQ EADSLTTQLQ       120
     RCETVLQAEC EASATARSEV ASRTTELAQL EERIAGLTAR LAEHQSHARS LEQKHDHARE       180
     ALEHYRTSVK DQREQEQRRH EHQVQELQVA LRQANEALTA KNHDLMQLNR ENGQWLERHT       240
     RLERELTQTR QRADAQQRER DALRLAAAEH QGLQARWTKD VQALEGVRAE LAAVRTDLIE       300
     ERQRREHAEA DTLRATVRLS TLEQLLAQLR PPRPVGEQVT SGKDETSPDA NSQLL            355
//

If you have problems or comments...

PBIL Back to PBIL home page