(data stored in ACNUC9435 zone)

EMBL: AM039951.PE96

AM039951.PE96        Location/Qualifiers
FT   CDS             104425..105138
FT                   /transl_table=11
FT                   /locus_tag="XCVd0096"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19908"
FT                   /db_xref="GOA:Q3C008"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19908.1"
FT                   /translation="MLKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAA
FT                   GRLRHLRDRAFVLLGFWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTY
FT                   KVPALSRWCPVAATMTWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVPLLRRIFREA
FT                   GLSSPDDYSGHSLRRGFAGWANANGWDVKALMEYVGWRDVHSAMRYLDGADPFARRRIE
FT                   ASLPEAPALPRPATT"
     MLKGIQTVHP SQEKRATPLQ LTQLGQVVDW LDGAATAAGT RDDAAGRLRH LRDRAFVLLG        60
     FWRGFRGDEL VRLQVQDLEL VAGEGMTCFL PHSKSDRQHA GTTYKVPALS RWCPVAATMT       120
     WVAAAALHEG PLFRAVNQWG GIAAAPLHPN SLVPLLRRIF REAGLSSPDD YSGHSLRRGF       180
     AGWANANGWD VKALMEYVGW RDVHSAMRYL DGADPFARRR IEASLPEAPA LPRPATT          237
//

If you have problems or comments...

PBIL Back to PBIL home page