(data stored in ACNUC9435 zone)

EMBL: AM039951.PE98

AM039951.PE98        Location/Qualifiers
FT   CDS             complement(108441..109667)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0098"
FT                   /product="putative replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19910"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19910.1"
FT                   /translation="MKKISELTAQPTSAEMLQWRDGYRHHLESKGIPPESAADLAAKVS
FT                   YRADLYPTDLAATRPLFQVEPPTAPGEQATDAKVPPLKDSRPDKAKPTKAAKLKRVEPA
FT                   ALERKPKTTTATAREERLIKTAAEIAGERPDDDDRAYMHSIMCQVGLPRSKVDGTSFER
FT                   HSGGAALLVEAGKLWDGKQFVQQPIPYGAMPRLMLAWMNTYAVRFNSPEIPVGDSASEF
FT                   LRMLGQKNITGGERGTFTNFRKQVQALSACRMTLGFNANGRAHTYEGKPIKHFEAWINL
FT                   EEKQRALWPGSVTFSQDYYLTLKDHAVPLDLRAFMELKGSALDLDVYAWLAQRLHRIEG
FT                   RPVVLYWTNLRDQFGQEYQGKEADKDFKKKFLPSLRRVLAVYPDAKVKQVTGGIMLMAS
FT                   PPPIPYKGS"
     MKKISELTAQ PTSAEMLQWR DGYRHHLESK GIPPESAADL AAKVSYRADL YPTDLAATRP        60
     LFQVEPPTAP GEQATDAKVP PLKDSRPDKA KPTKAAKLKR VEPAALERKP KTTTATAREE       120
     RLIKTAAEIA GERPDDDDRA YMHSIMCQVG LPRSKVDGTS FERHSGGAAL LVEAGKLWDG       180
     KQFVQQPIPY GAMPRLMLAW MNTYAVRFNS PEIPVGDSAS EFLRMLGQKN ITGGERGTFT       240
     NFRKQVQALS ACRMTLGFNA NGRAHTYEGK PIKHFEAWIN LEEKQRALWP GSVTFSQDYY       300
     LTLKDHAVPL DLRAFMELKG SALDLDVYAW LAQRLHRIEG RPVVLYWTNL RDQFGQEYQG       360
     KEADKDFKKK FLPSLRRVLA VYPDAKVKQV TGGIMLMASP PPIPYKGS                    408
//

If you have problems or comments...

PBIL Back to PBIL home page