(data stored in ACNUC9435 zone)

EMBL: AM039951.PILN

AM039951.PILN        Location/Qualifiers
FT   CDS             12131..13867
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="XCVd0012"
FT                   /product="putative PilN-like Bacterial type II and III
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19824"
FT                   /db_xref="GOA:Q3C092"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19824.1"
FT                   /translation="MKYIFTLAAAVTMLTGCSHSIRNADRSYNDVDGEAKKLLIDMRTP
FT                   AVPGQRETVTISNSQWVEPVPMAVTTPKLPAALRCDPGFKTLEPMGLLEFAQAVSESCK
FT                   MAVRVTADALSAFGSGDSNSATSGPSAGASVPVGGMPLPNLPMLPPVTGTAANASGGIG
FT                   GRAGGALLSNIEWKGPLAGLLDLVASRYGLSWRYSERNNSVSIFHVDSRTFQLDAFPNQ
FT                   VDIQSTTHNGMSSQLGSGGGGGGGGGGSGGGASSGGSSGGGVSGTVGSSQTTVTSMKSS
FT                   LYTDVESAIKVLLTPGIGRVALSPSTGAVTVTDTPDVLDRIGSMLERENTTLTKQVTLH
FT                   AKVLSLTLNDANEVGVNWDVVYRSLSRQFEFTTPFQPASSAGTLGASVINTGKFAGTNV
FT                   IVSALSTLGTVNTITSPSLKTLNLRPAPIQIARQIGYIQSAQISQTEGAGTLGGLTPGF
FT                   VTVGFNMTVVPRLLAQNEEMILQYSINISALNELRSEEAGGTKIEMPDIDTRNFNSEVR
FT                   LHAGETLILHGFEQENHSSNRRGMGSPFAWMLGGSARGQRQRTAIVILITPEVGSSISA
FT                   MR"
     MKYIFTLAAA VTMLTGCSHS IRNADRSYND VDGEAKKLLI DMRTPAVPGQ RETVTISNSQ        60
     WVEPVPMAVT TPKLPAALRC DPGFKTLEPM GLLEFAQAVS ESCKMAVRVT ADALSAFGSG       120
     DSNSATSGPS AGASVPVGGM PLPNLPMLPP VTGTAANASG GIGGRAGGAL LSNIEWKGPL       180
     AGLLDLVASR YGLSWRYSER NNSVSIFHVD SRTFQLDAFP NQVDIQSTTH NGMSSQLGSG       240
     GGGGGGGGGS GGGASSGGSS GGGVSGTVGS SQTTVTSMKS SLYTDVESAI KVLLTPGIGR       300
     VALSPSTGAV TVTDTPDVLD RIGSMLEREN TTLTKQVTLH AKVLSLTLND ANEVGVNWDV       360
     VYRSLSRQFE FTTPFQPASS AGTLGASVIN TGKFAGTNVI VSALSTLGTV NTITSPSLKT       420
     LNLRPAPIQI ARQIGYIQSA QISQTEGAGT LGGLTPGFVT VGFNMTVVPR LLAQNEEMIL       480
     QYSINISALN ELRSEEAGGT KIEMPDIDTR NFNSEVRLHA GETLILHGFE QENHSSNRRG       540
     MGSPFAWMLG GSARGQRQRT AIVILITPEV GSSISAMR                               578
//

If you have problems or comments...

PBIL Back to PBIL home page