(data stored in ACNUC9435 zone)

EMBL: AM039951.PILO

AM039951.PILO        Location/Qualifiers
FT   CDS             13907..15253
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="XCVd0013"
FT                   /product="putative PilO-like pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19825"
FT                   /db_xref="GOA:Q3C091"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C091"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19825.1"
FT                   /translation="MARRKSIDTSIADRQKIGTFVLNGRTFVSGLHWETLDNVSSFMKE
FT                   ARSKGRQWGMDVVATRKGVDLRSKGKSAKYQAGYAPKNRGAAKGMYSLASVLASEFGSN
FT                   WIGAFRIEEERYALAAVVDGSIVPSADRIGTLSEIREELGANFSHLAGSGVLFEHVIAP
FT                   PEFEFGDKQVDLASLLVASKLKPEHRLKPLTLGLSKGELFRLTLFAAIIVAGGALYILY
FT                   QAREEEMLRRADQAQKAARARAEALLNIKPPPPAPPPPWLASAKITDTVAACSAAIDKL
FT                   PLVLGGWIFEKASCNAGGALSAAYKRGHLATANSVLSAAEAAGLPLDFYDAGESGVVNV
FT                   LIHMPSASSEELLAEKQVMARLVSHFQAAGVKFPLQKQAIPETPPGEEPTTSKPNWSTY
FT                   TFEIVTQMPPVALLEGLAPDGLRAETVAVSLDGEAARLTWTINGALYVR"
     MARRKSIDTS IADRQKIGTF VLNGRTFVSG LHWETLDNVS SFMKEARSKG RQWGMDVVAT        60
     RKGVDLRSKG KSAKYQAGYA PKNRGAAKGM YSLASVLASE FGSNWIGAFR IEEERYALAA       120
     VVDGSIVPSA DRIGTLSEIR EELGANFSHL AGSGVLFEHV IAPPEFEFGD KQVDLASLLV       180
     ASKLKPEHRL KPLTLGLSKG ELFRLTLFAA IIVAGGALYI LYQAREEEML RRADQAQKAA       240
     RARAEALLNI KPPPPAPPPP WLASAKITDT VAACSAAIDK LPLVLGGWIF EKASCNAGGA       300
     LSAAYKRGHL ATANSVLSAA EAAGLPLDFY DAGESGVVNV LIHMPSASSE ELLAEKQVMA       360
     RLVSHFQAAG VKFPLQKQAI PETPPGEEPT TSKPNWSTYT FEIVTQMPPV ALLEGLAPDG       420
     LRAETVAVSL DGEAARLTWT INGALYVR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page