(data stored in ACNUC9435 zone)

EMBL: AM039951.PILQ

AM039951.PILQ        Location/Qualifiers
FT   CDS             15739..17349
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="XCVd0014"
FT                   /product="putative PilQ-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19826"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C090"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19826.1"
FT                   /translation="MVASVTSIAPESALPVAEPTKAVRYCRVLTAELGVYFVAESKRAV
FT                   VCLLADADGRSAELVVSSSHKTDPIVLSIFNILRRNAQNITWVTRYTQVSEIAKLYQLH
FT                   STNLVANDDDSARQDQVKGYIREANNMGASDLKIIVVGPYCRIRYTIHGRTKTYHELPA
FT                   AEGMLLSRALYNTMCAEMTGSGLDPNAMQDAQLKADVASQCGLVGSRISTRPANGRGIR
FT                   IVLRLLPPNRSAVQELEDLGYLPDSQIPILREVMALPFGIGLISGVTGSGKSTTLKAII
FT                   ENILRDSDQETDVLTIEDPVEYDIEAEGCTQTPLVYEQDDPEGRRNAWPNALRNAMRQA
FT                   PKIIVPGEIRDSESALIGYEAAVTGHFIWSTVHTFDAPSIIDRFRLLGVADDRLFNPAL
FT                   SVCLVNQSLLPQLCVSCRVPYLVGCAAIPAHVRTSIEEFCEVSKVYLQGPGCEECSGQT
FT                   PGVRGRKVAAEIIRPTAAFMEVFRRQGMVAARTYWVKQMGGITKLAHALTYVHSGLADP
FT                   RHVIRDVAALNTDRLHIGD"
     MVASVTSIAP ESALPVAEPT KAVRYCRVLT AELGVYFVAE SKRAVVCLLA DADGRSAELV        60
     VSSSHKTDPI VLSIFNILRR NAQNITWVTR YTQVSEIAKL YQLHSTNLVA NDDDSARQDQ       120
     VKGYIREANN MGASDLKIIV VGPYCRIRYT IHGRTKTYHE LPAAEGMLLS RALYNTMCAE       180
     MTGSGLDPNA MQDAQLKADV ASQCGLVGSR ISTRPANGRG IRIVLRLLPP NRSAVQELED       240
     LGYLPDSQIP ILREVMALPF GIGLISGVTG SGKSTTLKAI IENILRDSDQ ETDVLTIEDP       300
     VEYDIEAEGC TQTPLVYEQD DPEGRRNAWP NALRNAMRQA PKIIVPGEIR DSESALIGYE       360
     AAVTGHFIWS TVHTFDAPSI IDRFRLLGVA DDRLFNPALS VCLVNQSLLP QLCVSCRVPY       420
     LVGCAAIPAH VRTSIEEFCE VSKVYLQGPG CEECSGQTPG VRGRKVAAEI IRPTAAFMEV       480
     FRRQGMVAAR TYWVKQMGGI TKLAHALTYV HSGLADPRHV IRDVAALNTD RLHIGD           536
//

If you have problems or comments...

PBIL Back to PBIL home page