(data stored in ACNUC9435 zone)

EMBL: AM039951.PILR

AM039951.PILR        Location/Qualifiers
FT   CDS             17351..18448
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="XCVd0015"
FT                   /product="putative PilR-like integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19827"
FT                   /db_xref="GOA:Q3C089"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C089"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19827.1"
FT                   /translation="MAFADVWDSLSFDGIKSWAFKCYVKLGFGITARINFYESLTLSLD
FT                   NGESVLDTLEQQRAAFDEDGIAVLPAPQLVIINDCIRALTRGDQLADALEEWVGIQEVS
FT                   LVAAGESSGDLVAGLDRVVESLERRQELQRVLKEALMWPAFIGLGIVSAIFYISLELIP
FT                   ELLRMQPKEAWPAPTQKMISIGLFVVGNWFYMLAAFLIAASWLAWALPNLTGRIRDKFD
FT                   KLPFFSTYRVFVGTTFLLNVSALLAAGIPLEQALIDMARYANAYLRERIDDTLRGIKTG
FT                   ANFGQALHFTEHDFPDKDTVRNVKTLAEKKGFEVALEKFTKRWLKQNMKLMERSAAILR
FT                   LIMLLIGAYVIVTMFQGVYGIAQRR"
     MAFADVWDSL SFDGIKSWAF KCYVKLGFGI TARINFYESL TLSLDNGESV LDTLEQQRAA        60
     FDEDGIAVLP APQLVIINDC IRALTRGDQL ADALEEWVGI QEVSLVAAGE SSGDLVAGLD       120
     RVVESLERRQ ELQRVLKEAL MWPAFIGLGI VSAIFYISLE LIPELLRMQP KEAWPAPTQK       180
     MISIGLFVVG NWFYMLAAFL IAASWLAWAL PNLTGRIRDK FDKLPFFSTY RVFVGTTFLL       240
     NVSALLAAGI PLEQALIDMA RYANAYLRER IDDTLRGIKT GANFGQALHF TEHDFPDKDT       300
     VRNVKTLAEK KGFEVALEKF TKRWLKQNMK LMERSAAILR LIMLLIGAYV IVTMFQGVYG       360
     IAQRR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page