(data stored in ACNUC9435 zone)

EMBL: AM039951.PILT

AM039951.PILT        Location/Qualifiers
FT   CDS             18707..20026
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="XCVd0016"
FT                   /product="putative PilT-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19828"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C088"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19828.1"
FT                   /translation="MERVAPICCLLRSTASVSRPLCRLLVRRFQISSAAQLPWFLLVPV
FT                   SSSAQQRFLRKSAVALSQTYPSLGHTARRSMAGLGSPGRCRLPKQMLVAVRMPTRSLGR
FT                   SPTKPRVSSMQLKDLPVVDIYLGHDYSLMKDLPGAQAPGSAAPDQLKQELANVRGLCLE
FT                   MFEKSGDPEFALSLDGFVYRVTTFVDTSTHPVFVLSRAASKVIPIERLDIPKHAKEAVL
FT                   SPRTRGIVLVTGEMGSGKTVTATTLFVERLRQTRSIGLALEDPIESNLNGPHGDGWCIH
FT                   VQVSRREGGYREYLIRSMRSRAETIYLGELRDESSAEQAVQLSNMGHLVFTTVHGGDLP
FT                   QAIERILSLSRGLRDPSGMLAEGLAVIIHQKLVHSTALPGGTSIPRLVAKALTLVPAHG
FT                   DERGEAFSKSARALIRTNELSKLQTLIEQQSNAATWRGNP"
     MERVAPICCL LRSTASVSRP LCRLLVRRFQ ISSAAQLPWF LLVPVSSSAQ QRFLRKSAVA        60
     LSQTYPSLGH TARRSMAGLG SPGRCRLPKQ MLVAVRMPTR SLGRSPTKPR VSSMQLKDLP       120
     VVDIYLGHDY SLMKDLPGAQ APGSAAPDQL KQELANVRGL CLEMFEKSGD PEFALSLDGF       180
     VYRVTTFVDT STHPVFVLSR AASKVIPIER LDIPKHAKEA VLSPRTRGIV LVTGEMGSGK       240
     TVTATTLFVE RLRQTRSIGL ALEDPIESNL NGPHGDGWCI HVQVSRREGG YREYLIRSMR       300
     SRAETIYLGE LRDESSAEQA VQLSNMGHLV FTTVHGGDLP QAIERILSLS RGLRDPSGML       360
     AEGLAVIIHQ KLVHSTALPG GTSIPRLVAK ALTLVPAHGD ERGEAFSKSA RALIRTNELS       420
     KLQTLIEQQS NAATWRGNP                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page