(data stored in ACNUC9435 zone)

EMBL: AM039951.RDGC

AM039951.RDGC        Location/Qualifiers
FT   CDS             142680..143591
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="XCVd0134"
FT                   /product="recombination associated protein / putative
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19946"
FT                   /db_xref="GOA:Q3BZX0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19946.1"
FT                   /translation="MAFFRNLTLFRFPTATDFSEVDQLLPAVVLKPVGPLEMNSRGFMS
FT                   PFGREQQVTLSHRLGDFLWLTVGGEDKILPAAVVNDALARKISEIEAKEGRKPGGRERK
FT                   RIKDDLIHELLPRAFVKSSRTDAVLDLRNGYIAVDTSSRKTAESVMSQIRGLLGSFPAM
FT                   PLNAEVAPRGVLTGWIAGEPLPEGLSLGEECEMKDPVEGGATVRCSAQELRSDEIDRHL
FT                   DAGKQVTKLAMVLDDHLSFVAGDDLVIRKLKFLDGALDQLEEADQEGLRAEFDARFALM
FT                   SGELRRLFSLLETAFKLSAAEA"
     MAFFRNLTLF RFPTATDFSE VDQLLPAVVL KPVGPLEMNS RGFMSPFGRE QQVTLSHRLG        60
     DFLWLTVGGE DKILPAAVVN DALARKISEI EAKEGRKPGG RERKRIKDDL IHELLPRAFV       120
     KSSRTDAVLD LRNGYIAVDT SSRKTAESVM SQIRGLLGSF PAMPLNAEVA PRGVLTGWIA       180
     GEPLPEGLSL GEECEMKDPV EGGATVRCSA QELRSDEIDR HLDAGKQVTK LAMVLDDHLS       240
     FVAGDDLVIR KLKFLDGALD QLEEADQEGL RAEFDARFAL MSGELRRLFS LLETAFKLSA       300
     AEA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page