(data stored in ACNUC9435 zone)

EMBL: AM039951.REPA

AM039951.REPA        Location/Qualifiers
FT   CDS             456..1748
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="XCVd0001"
FT                   /product="Replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19813"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19813.1"
FT                   /translation="MSTTAEQSPTPSIGADYLVQLGDRIGQMVMRAKDFSHPSKLSPEQ
FT                   GESRRLSLREIADSIGVSHSTVNRVAANMMGPDAAGGTESPKSTGRTGYRYSLAEAVAL
FT                   RKAIAELPEIRKKAKLDRRRGAGEPCVTLGIMNFKGGVAKSTTTAHAGAYLSLHGYRTL
FT                   VIDTDPQATLSTLFGIHPDIELSVEDTLLPYFEGSETSLDYCIRKTEIPTLDVIPSNVG
FT                   LASADLVLPSRQRDMRQAGDLSWFYMKVLAEGIATIEKDYDVILIDCPPSMSYLTTVAT
FT                   QACDALLVPMRPSMPDFASSAQFIRMFGGFQREVDEVVGNAKEFDWIQVLITLGENNNA
FT                   SAEMEAIIRKAYGDLVMGEKFPYLTAVARAAKAMRTIYDVARADTDTRQLSKAMNIVNQ
FT                   LCQSIEARLLLTRARLTAQSNGNQGETEEAV"
     MSTTAEQSPT PSIGADYLVQ LGDRIGQMVM RAKDFSHPSK LSPEQGESRR LSLREIADSI        60
     GVSHSTVNRV AANMMGPDAA GGTESPKSTG RTGYRYSLAE AVALRKAIAE LPEIRKKAKL       120
     DRRRGAGEPC VTLGIMNFKG GVAKSTTTAH AGAYLSLHGY RTLVIDTDPQ ATLSTLFGIH       180
     PDIELSVEDT LLPYFEGSET SLDYCIRKTE IPTLDVIPSN VGLASADLVL PSRQRDMRQA       240
     GDLSWFYMKV LAEGIATIEK DYDVILIDCP PSMSYLTTVA TQACDALLVP MRPSMPDFAS       300
     SAQFIRMFGG FQREVDEVVG NAKEFDWIQV LITLGENNNA SAEMEAIIRK AYGDLVMGEK       360
     FPYLTAVARA AKAMRTIYDV ARADTDTRQL SKAMNIVNQL CQSIEARLLL TRARLTAQSN       420
     GNQGETEEAV                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page