(data stored in ACNUC9435 zone)

EMBL: AM039951.REPB

AM039951.REPB        Location/Qualifiers
FT   CDS             1745..2743
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="XCVd0002"
FT                   /product="Replication protein B"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19814"
FT                   /db_xref="GOA:Q3C0A2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19814.1"
FT                   /translation="MSKQKARSAALLGAMDGEGFPPLAHGAGSGSARPDSSVPALGMVS
FT                   ELARDELRLARERVAQLQGQLDAVAAAGSVQLVDPAKITHTQYRDRDELGFRDEKYEEL
FT                   KEDIRRKGRNEQPILLRPARAENVAAGFEFEVVWGHRRHRVTSELGIPVEAIVRDVTDR
FT                   EAVLLMSSENARREGLSQYEQARKYRTWLKAGLFENMVAIAEAEGVHKATISRIMSIND
FT                   LPDEVFVALKDPRKVTGLFAAKFLQAAETNEEAVESLKDLEKKLTPGELLKKVAPVGPK
FT                   MDPIEFKAGERRIFEAVPVAAEGGTKFSELRLHIELDQDKLRRLAEFAASL"
     MSKQKARSAA LLGAMDGEGF PPLAHGAGSG SARPDSSVPA LGMVSELARD ELRLARERVA        60
     QLQGQLDAVA AAGSVQLVDP AKITHTQYRD RDELGFRDEK YEELKEDIRR KGRNEQPILL       120
     RPARAENVAA GFEFEVVWGH RRHRVTSELG IPVEAIVRDV TDREAVLLMS SENARREGLS       180
     QYEQARKYRT WLKAGLFENM VAIAEAEGVH KATISRIMSI NDLPDEVFVA LKDPRKVTGL       240
     FAAKFLQAAE TNEEAVESLK DLEKKLTPGE LLKKVAPVGP KMDPIEFKAG ERRIFEAVPV       300
     AAEGGTKFSE LRLHIELDQD KLRRLAEFAA SL                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page