(data stored in ACNUC9435 zone)

EMBL: AM039951.SSB

AM039951.SSB         Location/Qualifiers
FT   CDS             138942..139295
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="XCVd0129"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19941"
FT                   /db_xref="GOA:Q3BZX5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19941.1"
FT                   /translation="MPRKSECRVDCMGFVANEPQLRQANGTPVVNLVVIENEYWKDAEG
FT                   TRKERSHAHSIAFWGPYAETVSKLVQKGSYVRVKGNLRYKPIEGQQYDKAAEIRGDDFS
FT                   LLDDPRERDESPD"
     MPRKSECRVD CMGFVANEPQ LRQANGTPVV NLVVIENEYW KDAEGTRKER SHAHSIAFWG        60
     PYAETVSKLV QKGSYVRVKG NLRYKPIEGQ QYDKAAEIRG DDFSLLDDPR ERDESPD          117
//

If you have problems or comments...

PBIL Back to PBIL home page