(data stored in ACNUC9435 zone)

EMBL: AM180355.CHEW

AM180355.CHEW        Location/Qualifiers
FT   CDS             640397..640915
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="CD630_05360"
FT                   /old_locus_tag="CD0536"
FT                   /product="Purine-binding chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67369"
FT                   /db_xref="GOA:Q188Y3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q188Y3"
FT                   /protein_id="CAJ67369.1"
FT                   /translation="MRFPDDPYLDYGLIDEGIKYLKFKVDEQDFGVELEKIIEITGNQE
FT                   IIFIPELPTYSKGIINLRGKIIPIIDMRLRLKKDELMTTNCMYIVVTEIKDLVVGFVVD
FT                   RVDDIVSLEKSKISPPPRVTIEYSDYFVSGVGELEGKIITLLDLEKLLTDKDEVLIDEL
FT                   INGFDCTIM"
     MRFPDDPYLD YGLIDEGIKY LKFKVDEQDF GVELEKIIEI TGNQEIIFIP ELPTYSKGII        60
     NLRGKIIPII DMRLRLKKDE LMTTNCMYIV VTEIKDLVVG FVVDRVDDIV SLEKSKISPP       120
     PRVTIEYSDY FVSGVGELEG KIITLLDLEK LLTDKDEVLI DELINGFDCT IM               172
//

If you have problems or comments...

PBIL Back to PBIL home page