(data stored in ACNUC9435 zone)

EMBL: AM180355.FDXA

AM180355.FDXA        Location/Qualifiers
FT   CDS             complement(228980..229150)
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="CD630_01721"
FT                   /old_locus_tag="CD0172A"
FT                   /product="Ferredoxin (4Fe-4S cluster-containing protein)
FT                   (fdx-like)"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01721"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66994"
FT                   /db_xref="GOA:Q18CR3"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CR3"
FT                   /protein_id="CAJ66994.1"
FT                   /translation="MAYKITDACISCGACEAECPVSCISAGDDAYVIDAGSCIDCGSCA
FT                   GACPVDAPQPE"
     MAYKITDACI SCGACEAECP VSCISAGDDA YVIDAGSCID CGSCAGACPV DAPQPE            56
//

If you have problems or comments...

PBIL Back to PBIL home page