(data stored in ACNUC9435 zone)

EMBL: AM180355.FLGE

AM180355.FLGE        Location/Qualifiers
FT   CDS             317397..318380
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="CD630_02550"
FT                   /old_locus_tag="CD0255"
FT                   /product="Flagellar hook protein FlgE (Distal rod protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67076"
FT                   /db_xref="GOA:Q18CZ4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CZ4"
FT                   /protein_id="CAJ67076.1"
FT                   /translation="MIKAMYSGVSGMKANQTKLDVIGNNVANAGTTSFKKSSARITDSF
FT                   YQTVLYASAPTAALGGTNLGQVGVGSKISSINKDMVQGNVQPTNRPSDLMIDGDGYLPV
FT                   VRQGTVMYTRDGSFNLDTGFKAADGALKNIKGGRLVNGDGYMLQGMIYDGEYKADTGEF
FT                   VKKGDAKGKEPIVIPLQSISPKDGTVQNVLEYNISKDGTVEFLLSDGQRTQFVYDIPDG
FT                   AKVGDTPAGIDKLKGTIQKVQIYAFQNPAGLDAAGGNLFKPSANSGDPQIAGATGTIIQ
FT                   GAIEASNVDIAEEFTEMIIASRSFQANSKIISTSDEILQEIINLKR"
     MIKAMYSGVS GMKANQTKLD VIGNNVANAG TTSFKKSSAR ITDSFYQTVL YASAPTAALG        60
     GTNLGQVGVG SKISSINKDM VQGNVQPTNR PSDLMIDGDG YLPVVRQGTV MYTRDGSFNL       120
     DTGFKAADGA LKNIKGGRLV NGDGYMLQGM IYDGEYKADT GEFVKKGDAK GKEPIVIPLQ       180
     SISPKDGTVQ NVLEYNISKD GTVEFLLSDG QRTQFVYDIP DGAKVGDTPA GIDKLKGTIQ       240
     KVQIYAFQNP AGLDAAGGNL FKPSANSGDP QIAGATGTII QGAIEASNVD IAEEFTEMII       300
     ASRSFQANSK IISTSDEILQ EIINLKR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page