(data stored in ACNUC9435 zone)

EMBL: AM180355.FLGG

AM180355.FLGG        Location/Qualifiers
FT   CDS             329825..330586
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="CD630_02690"
FT                   /old_locus_tag="CD0269"
FT                   /product="Flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67091"
FT                   /db_xref="GOA:Q18D04"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D04"
FT                   /protein_id="CAJ67091.1"
FT                   /translation="MYTMFYTSKTALSANQSKLDIISNNIANSDSTGYKKINMEYSDLV
FT                   DEVLNRPSYPTNGNDISTGTGAKATAPMRNYEQGALAPTDSKSNLAIDGEGFFRVIRKD
FT                   GTYAYTRNGGFNVDALGKIVDDNGNILDVQFDAGYNYNNTNIDSTNLTVSRNGELFVDN
FT                   KKIGKINLYQPIGTQNFISEGDSLFVATDAAQIKQVEKVDIVQGYRERSNVSLQEEFVD
FT                   LIATQRAFQMNSKGIKTADEMWQIANNLRAK"
     MYTMFYTSKT ALSANQSKLD IISNNIANSD STGYKKINME YSDLVDEVLN RPSYPTNGND        60
     ISTGTGAKAT APMRNYEQGA LAPTDSKSNL AIDGEGFFRV IRKDGTYAYT RNGGFNVDAL       120
     GKIVDDNGNI LDVQFDAGYN YNNTNIDSTN LTVSRNGELF VDNKKIGKIN LYQPIGTQNF       180
     ISEGDSLFVA TDAAQIKQVE KVDIVQGYRE RSNVSLQEEF VDLIATQRAF QMNSKGIKTA       240
     DEMWQIANNL RAK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page