(data stored in ACNUC9435 zone)

EMBL: AM180355.FLGG1

AM180355.FLGG1       Location/Qualifiers
FT   CDS             329031..329804
FT                   /transl_table=11
FT                   /gene="flgG1"
FT                   /locus_tag="CD630_02680"
FT                   /old_locus_tag="CD0268"
FT                   /product="Flagellar hook-basal body complex protein FlgG1"
FT                   /note="experimentally verified through Mass Spectrometry as
FT                   part of Spo0A regulated proteome: up-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67090"
FT                   /db_xref="GOA:Q18D05"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D05"
FT                   /protein_id="CAJ67090.1"
FT                   /translation="MIRGLYIAVSAMITNQQKQNVVVNNLANMDTNGYKSKQLLTKSFD
FT                   ELKLEGYNNYANGTKQKQIIGDISPGISMDETITNFNQGPIKTTDNKMDVAIQGKGFFL
FT                   VSDAAGNQFYTRNGNFRTDNQGDLITSEGYYVLGTNTATGAVGHINVGNQKFEVAKDNT
FT                   ISLDGNAMYKFNIVDFNNYNNLKKEGDNLYSGGGAMKVNNALTIQSAIESSNVDMVSEI
FT                   NNMMTISREYEANQKIIQAMDSKLAKIASEIGSVR"
     MIRGLYIAVS AMITNQQKQN VVVNNLANMD TNGYKSKQLL TKSFDELKLE GYNNYANGTK        60
     QKQIIGDISP GISMDETITN FNQGPIKTTD NKMDVAIQGK GFFLVSDAAG NQFYTRNGNF       120
     RTDNQGDLIT SEGYYVLGTN TATGAVGHIN VGNQKFEVAK DNTISLDGNA MYKFNIVDFN       180
     NYNNLKKEGD NLYSGGGAMK VNNALTIQSA IESSNVDMVS EINNMMTISR EYEANQKIIQ       240
     AMDSKLAKIA SEIGSVR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page