(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIF

AM180355.FLIF        Location/Qualifiers
FT   CDS             310353..311903
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="CD630_02480"
FT                   /old_locus_tag="CD0248"
FT                   /product="Flagellar M-ring protein FliF"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67069"
FT                   /db_xref="GOA:Q18CY4"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY4"
FT                   /protein_id="CAJ67069.1"
FT                   /translation="MITSFKNKIKEQVAKSRTKISSLKKGTKIALGIGVIAICLALVFT
FT                   AISASKNKYAVLFSELDAQDAADISAELESKKIDTKVKGSTIYVPRTEVDKLRLELAPS
FT                   LTGGSKGFALMDDSSSIGLTDEEFQIKKQRMIQGEIEKTIKSFPQVEDTRVHITFGESS
FT                   VFEKEAVPGSAAVYLMLKPGTTLEKNQIKSVMALISGSVTNIPEKNVQVIDNKMNLLSE
FT                   GILEDENVDENNQPINSGISVDKNKASEQALNKQLEKSILEMLEPIFGKGKVKATVNAD
FT                   LSFDTAEKTEIKIDPDKVAIKETRSKNSSKSAANNVQGVDANMNNQGNNNGTNTEDSLD
FT                   ESFEYETGKIETHTIVAPGELNRLTASVAIDGKIAKGVQADVEDIVNNAIGMDGARGDT
FT                   LSVVSMVFDPEGKKEAKQELEEIKKEGFKKNIIKAVIGVVAVIAVGAIGYLIYKKRSER
FT                   EDMDYEDEDYISKSDSVDRKDNPLLGDDPELTLEEAVKMYAEEKPDQVTEIIKTWLNE"
     MITSFKNKIK EQVAKSRTKI SSLKKGTKIA LGIGVIAICL ALVFTAISAS KNKYAVLFSE        60
     LDAQDAADIS AELESKKIDT KVKGSTIYVP RTEVDKLRLE LAPSLTGGSK GFALMDDSSS       120
     IGLTDEEFQI KKQRMIQGEI EKTIKSFPQV EDTRVHITFG ESSVFEKEAV PGSAAVYLML       180
     KPGTTLEKNQ IKSVMALISG SVTNIPEKNV QVIDNKMNLL SEGILEDENV DENNQPINSG       240
     ISVDKNKASE QALNKQLEKS ILEMLEPIFG KGKVKATVNA DLSFDTAEKT EIKIDPDKVA       300
     IKETRSKNSS KSAANNVQGV DANMNNQGNN NGTNTEDSLD ESFEYETGKI ETHTIVAPGE       360
     LNRLTASVAI DGKIAKGVQA DVEDIVNNAI GMDGARGDTL SVVSMVFDPE GKKEAKQELE       420
     EIKKEGFKKN IIKAVIGVVA VIAVGAIGYL IYKKRSERED MDYEDEDYIS KSDSVDRKDN       480
     PLLGDDPELT LEEAVKMYAE EKPDQVTEII KTWLNE                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page