(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIH

AM180355.FLIH        Location/Qualifiers
FT   CDS             312979..313710
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="CD630_02500"
FT                   /old_locus_tag="CD0250"
FT                   /product="Flagellar assembly protein FliH"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   . Experimentally verified through Mass Spectrometry as part
FT                   of Spo0A regulated proteome: down-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67071"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY9"
FT                   /protein_id="CAJ67071.1"
FT                   /translation="MNNKIIKSKKASYKGVLDLSIIDKVRVGESNLNKENDCRFRDEVI
FT                   KEAIESAEIKKNEILEEAKINAQNIEKQAYEKGYSQGQKNGYEDGYKESYDEYTQKAKD
FT                   EADFIKNQANLILLQANEKMTEYIKEKNKEIVRLAINMASSVLKKHFEDEESMSDLLKQ
FT                   IIQDYEGSSSFIVRCSSFYKDNIEKEFKLFKEETSLKSSVFVIADDSIDKGNAIIQKEN
FT                   GRIIVGIDCAMEKLKEELLGE"
     MNNKIIKSKK ASYKGVLDLS IIDKVRVGES NLNKENDCRF RDEVIKEAIE SAEIKKNEIL        60
     EEAKINAQNI EKQAYEKGYS QGQKNGYEDG YKESYDEYTQ KAKDEADFIK NQANLILLQA       120
     NEKMTEYIKE KNKEIVRLAI NMASSVLKKH FEDEESMSDL LKQIIQDYEG SSSFIVRCSS       180
     FYKDNIEKEF KLFKEETSLK SSVFVIADDS IDKGNAIIQK ENGRIIVGID CAMEKLKEEL       240
     LGE                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page