(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIM

AM180355.FLIM        Location/Qualifiers
FT   CDS             330609..331490
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="CD630_02700"
FT                   /old_locus_tag="CD0270"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67092"
FT                   /db_xref="GOA:Q18D13"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D13"
FT                   /protein_id="CAJ67092.1"
FT                   /translation="MNDMKEYDFGKPQSYSRENLTCLNFLLAEFCKKYKNYIIYELKCN
FT                   SSMVVDSIDQVNYQTFLDRVTSSCVVVQNAMEPVMKNFSFRIDRSVADMWIDITSGGTG
FT                   VVKDNDRELTELDKKVLLHLMDDLVRNMHLFEGFENIQVLDTHTHINLPQLCSPTAPVC
FT                   VVDLKVLNDNECIGSVSLCFPYNGLEALLESISVIEFFDNDVGDDSEEFTQKIYNSVSN
FT                   IELSVIAEIGKVSINVEDLLKLEVGDVIVTNKKINDYIDIFVENSKSYTATPGFISSKK
FT                   GVKINDAVGKEV"
     MNDMKEYDFG KPQSYSRENL TCLNFLLAEF CKKYKNYIIY ELKCNSSMVV DSIDQVNYQT        60
     FLDRVTSSCV VVQNAMEPVM KNFSFRIDRS VADMWIDITS GGTGVVKDND RELTELDKKV       120
     LLHLMDDLVR NMHLFEGFEN IQVLDTHTHI NLPQLCSPTA PVCVVDLKVL NDNECIGSVS       180
     LCFPYNGLEA LLESISVIEF FDNDVGDDSE EFTQKIYNSV SNIELSVIAE IGKVSINVED       240
     LLKLEVGDVI VTNKKINDYI DIFVENSKSY TATPGFISSK KGVKINDAVG KEV              293
//

If you have problems or comments...

PBIL Back to PBIL home page